2.17 Rating by ClearWebStats
alplist.com is 1 decade 6 years 8 months old. This website has a #16,662 rank in global traffic. It has a .com as an domain extension. This website has a Google PageRank of 3 out of 10. This domain is estimated value of $ 498,960.00 and has a daily earning of $ 693.00. While no active threats were reported recently by users, alplist.com is SAFE to browse.
Get Custom Widget

Traffic Report of Alplist

Daily Unique Visitors: 57,749
Daily Pageviews: 346,494

Estimated Valuation

Income Per Day: $ 693.00
Estimated Worth: $ 498,960.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: 5,426

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: View alplist.com Pagerank
Alexa Rank: 16,662
Domain Authority: Not Applicable
Google Pagerank
PR 3 out of 10
PageSpeed Score
91
Siteadvisor Rating
View alplist.com site advisor rating Not Applicable

Where is alplist.com server located?

Hosted IP Address:

173.237.137.16 View other site hosted with alplist.com

Hosted Country:

alplist.com hosted country US alplist.com hosted country

Location Latitude:

30.3423

Location Longitude:

-97.6673

Social Engagement

Facebook Shares: 1
Facebook Likes: 1
Facebook Comments: Not Applicable
Twitter Count (Tweets): 22
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View alplist.com HTML resources

Homepage Links Analysis

Add website, add your company, free listing

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 30
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 173.237.137.16)



No Nonsense Fat Melting System Review - Does It Work? PDF Download!

alplist.com favicon - nononsensefatmeltingsystemreviews.com

Don’t buy Ted Tanner's No Nonsense Fat Melting System before Reading this Review! Find out if this product really works, and if its the right for you.

View alplist.com Pagerank   alplist.com alexa rank Not Applicable   alplist.com website value $ 8.95

Finetest Functional ATE and Power Supply Testers

alplist.com favicon - finetest2.com

Power Supply Testers, Functional ATE, Military and Aerospace Systems, Functional ATE Systems, Power Supply Test Systems, Hi-Pot Test Systems, ESS Monitoring Systems, Burnin Monitoring Systems, Vibration Monitoring Systems, Manual Test Systems, Test Fixtures and ITAs, Box Builds and Sub-Assemblies, Switching Cards, IO Cards, Custom Cabinets, Custom Cabinet Accessories, Fixtures, Test Programs, UPS Testers, Burn-In, Hipot, Military Power...

View alplist.com Pagerank   alplist.com alexa rank Not Applicable   alplist.com website value $ 8.95

Websites Directory Network

alplist.com favicon - websitedirectorynetwork.com

View alplist.com Pagerank   alplist.com alexa rank 769,618   alplist.com website value $ 960.00

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Fri, 31 Oct 2014 00:27:45 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=15
Vary: Accept-Encoding
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
ngpass_all: 1
Content-Encoding: gzip

Domain Information for alplist.com

Domain Registrar: FBS INC. alplist.com registrar info
Registration Date: 2007-08-27 1 decade 6 years 8 months ago
Last Modified: 2014-08-04 9 years 8 months 3 weeks ago
Expiration Date: 2015-08-27 8 years 8 months 1 day ago

Domain Nameserver Information

Host IP Address Country
ns1.speedydns.net alplist.com name server information 162.214.130.229 alplist.com server is located in United States United States
ns2.speedydns.net alplist.com name server information 162.214.129.84 alplist.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
alplist.com A 3618 IP:173.237.137.16
alplist.com NS 21599 Target:ns1.speedydns.net
alplist.com NS 21599 Target:ns2.speedydns.net
alplist.com SOA 21599 MNAME:ns1.speedydns.net
RNAME:none.none.com
Serial:2013110801
Refresh:86400
Retry:7200
Expire:3600000
alplist.com MX 21599 Target:alplist.com

Similarly Ranked Websites to Alplist

Punjabi News, India Breaking News, in Punjabi by Punjabi Online Newspaper

alplist.com favicon - jagbani.com

Now read punjabi news in jagbani website, Latest News in punjabi is avaialable on jagbani. Punjab, India, International, world news in punjabi newspaper.

View alplist.com Pagerank   Alexa rank for alplist.com 16,664   website value of alplist.com $ 498,960.00

MPHPS

alplist.com favicon - millparkhtsps.vic.edu.au

View alplist.com Pagerank   Alexa rank for alplist.com 16,664   website value of alplist.com $ 498,960.00

BriefingWire - Free Press Release Submission

alplist.com favicon - briefingwire.com

Free Press Release submission and distribution service. Increase the visibility of your business by submitting your press release for free.

View alplist.com Pagerank   Alexa rank for alplist.com 16,665   website value of alplist.com $ 498,960.00

Business Intelligence - Visualization, Reporting, Dashboards | Domo

alplist.com favicon - domo.com

Domo: business intelligence, data visualization, dashboards and reporting all together. Simplify your big data and improve your business with Domo's agile and mobile-ready platform.

View alplist.com Pagerank   Alexa rank for alplist.com 16,665   website value of alplist.com $ 498,960.00

Store Files Easily on PutLocker

alplist.com favicon - putlocker.ws

View alplist.com Pagerank   Alexa rank for alplist.com 16,667   website value of alplist.com $ 498,960.00